Tulosta

Tutkimus:
Vastasyntyneiden aineenvaihduntasairauksien seulonta, ilman hypotyreoosiseulontaa, verestä (Päijät-Häme)

Luokitus:
Alihankittavat, Kemia

Käyttöönottopäivä:
27.5.2021

13635 • B -VasSeu2

Indikaatiot

Synnynnäisten aineenvaihduntasairauksien seulonta.

Suorituspaikka
TYKSLAB, Synnynnäisten aineenvaihduntasairauksien seulontakeskus (Saske), Turku

Lähete
Sähköinen laboratoriolähete tulee tehdä vasta siinä vaiheessa, kun näyte vauvasta voidaan ottaa tai vauvan kotiutumisen yhteydessä, jos näyte otetaan laboratorion näytteenotossa kotiutumisen jälkeen (Näytteenottopaikat: keskussairaalan polikliininen näytteenotto, Lahden kaupunginsairaala, Heinola ja Orimattila). Näyte otetaan syntymähetkestä 48-120 tunnin iässä. Poikkeustapauksissa (esim. hoitotoimenpiteistä johtuen, keskosilta) näyte voidaan ottaa 5 vrk (120 t) jälkeen. Jos vauva tarvitsee verensiirtoja, näytteenotto ajoitetaan mahdollisuuksien mukaan ennen verensiirtoa tai 72 h verensiirron jälkeen. Ehdoton minimiaika syntymähetkestä on 47 tuntia. Tätä aikaisempia näytteitä ei määritetä.

Tutkimusta tilatessa osasto täyttää pakolliset lisätiedot: raskauden kesto täysinä kokonaisina viikkoina (esim. 30), lapsen paino grammoina, tarkka syntymäkelloaika muodossa hhmm (esim 1253), lapsen ravitsemustiedot sekä verensiirtotiedot. Lisätiedot on kirjattava täsmälleen oikeassa muodossa, muutoin pyyntö ei siirry Saskeen. Ei-pakollisena lisätietona ovat kliiniset tiedot, jotka on täytettävä silloin, kun on esim. jokin tautiepäily.

VasSeu2-tutkimuspyyntö tehdään pääsääntöisesti kiertoajoille: klo 7, 12 tai 17. Mikäli näytteenotto tapahtuu hoitoyksikössä kiertoaikojen ulkopuolella, tehdään tutkimuspyyntö heti-tilauksena ja tulostetaan tarrat näytteenottoa varten. Osastolla otettavista näytteistä on ilmoitettava laboratorion päivystysnumeroon puh (044 719) 5428.
Jos sähköinen lähete tehdään vauvalle, josta näyte otetaan kotiutumisen jälkeen laboratorion näytteenotossa, toimitaan kuten muissakin hajautetun näytteenoton lähetteissä.

Mikäli näyte otetaan laboratorion näytteenotossa, tulee vanhemmat ohjeistaa menemään lähimpään ylläluetelluista näytteenottopaikoista, ennen kuin vauva on 120 tunnin ikäinen. Näytteenottoon voi varata ajan laboratorion puhelinajanvarauksesta puh 03 819 4511.

Tiedustelut
Päijät-Häme: näytteiden lajittelu ja lähetys, p. (044 440) 6123. 

Näyte
Erillinen TYKSLABin näytteenottokortti

Ohjeet laboratorion henkilökunnalle
Näytekortin näytealueelle ei saa koskettaa kädellä, vauvan kantapäällä eikä kapillaarilla.

Näyte otetaan ihopistonäytteenä kantapäästä joko käyttämällä näytteen annosteluun lisäaineetonta 100 µl lasikapillaaria tai tiputtamalla veripisarat suoraan kortin näyteympyröille. Kapillaari laitetaan hyvin lähelle kortin näyteympyrää, jolloin näyte imeytyy ympyrään. Näytteet voi ottaa samalla kapillaarilla, mikäli näyte tulee hyvin. Näytteen tulee imeytyä paperin läpi. Yhteen ympyrään annostellaan näytettä vain kerran, ei kerroksittain.

Näytteeksi riittää kolme onnistuneesti saatua näyteympyrää. Mikäli näytteenotto ei onnistu laadukkaasti, mutta näytteenottoa ei voida uusia, puutteellisenkin laadun omaava näyte kannattaa lähettää Saskeen. Jos näytteenotossa on ollut vaikeuksia, kapillaari on koskenut johonkin näyteympyrään, näyte on jouduttu ottamaan kanyylistä tai näyte on otettu myöhemmin kuin 120 tunnin iässä, näytekorttiin tulee kirjoittaa näistä maininta.

Näytetunnistetarra liimataan näytekorttiin oikeaan alakulmaan ruutuun, jossa lukee ’Kommentteja’, mahdollisimman kauas näytekortin viivakoodista. Näytekortti tuodaan laboratorioon vaaka-asennossa kuitenkin huolehtien, etteivät näytekortit pääse koskettamaan toisiaan. Näytekorttien pitää kuivua vähintään 3 tuntia vaakatasossa. Näytteen kuivumista ei saa nopeuttaa lisälämmöllä, eikä näytekortti saa olla suorassa auringon valossa. Näytekortteja ei saa taittaa näytteen kohdalta.

Kuivuneet näytekortit pakataan yksittäin muovipusseihin. Aluetoimipisteistä kuivat näytekortit lähetetään seuraavana päivänä yksittäispakattuina PHKS:aan.

Näytekortit tulee lähettää Saskeen viikon kuluessa.

Huom! Erikoistapauksessa Saskeen voidaan lähettää näytteitä myös väliaikaisella henkilötunnuksella niistä vauvoista, joiden näyte tulee lähettää kiireellisenä (ilmoitettava puhelimitse laboratorion näytteiden lajitteluun) sekä vauvoista, jotka eivät saa suomalaista henkilötunnusta syntymän jälkeen, esim ulkomaalaiset.

Menetelmä
Näytteestä määritetään amino- ja rasvahappojen sekä 17alfa-OH-progesteronin pitoisuudet nestekromatografia-tandem-massaspektrometriaa ja immunokemiallisia menetelmiä käyttäen.

Tekotiheys / kesto
Tulokset ovat valmiina 2-3 viikon kuluessa.

Viitearvot, tulkinta
Normaalit tulokset vastataan ”Normaali”. Poikkeavasta seulontatuloksesta annetaan erillinen lausunto ja Tyksin lastenklinikan asiantuntijalääkäri ottaa myös puhelimitse yhteyttä suoraan hoitoyksikköön.

Synnynnäiset aineenvaihduntasairaudet ovat harvinaisia sairauksia (esiintyvyys alle n. 1:2000), joiden hoito on tärkeää aloittaa mahdollisimman varhain, jotta voidaan estää elimistön vauriot sekä lapsen pysyvä, vaikea vammautuminen ja mahdollinen kuolema. Seulontatutkimuksen avulla voidaan ajoissa tunnistaa ne sairaat lapset, joille varhainen taudin tunnistaminen ja hoidon aloitus ovat elintärkeitä.

Sosiaali- ja terveysministeriö suosittelee 7.4.2014 kunnille ja sairaanhoitopiireille lähettämässään kirjeessä viiden synnynnäisen aineenvaihduntasairauden (CAH, MCAD, LCHAD, GA 1 ja PKU) seulonnan tarjoamista kaikille Suomessa syntyville lapsille vuodesta 2015 alkaen. B-VasSeu2 -tutkimus on suositusta laajempi, lista seulonnassa etsittävistä hormoni- tai aminohappo- ja rasvahappoaineenvaihdunnan sairauksista ja orgaanisten happojen kertymiseen johtavista sairauksista on alla.

B-VasSeu2 -tutkimuksella seulottavat aineenvaihduntataudit (1.5.2016):

Aminohappojen aineenvaihdunnan sairaudet
– Fenyyliketonuria (PKU)
– Homokystinuria
– Hyperornitinemia-gyrata-atrofia (HOGA-tauti)
– Tyrosinemia tyyppi 1
– Vaahterasiirappitauti (MSUD)
Endokrinologiset sairaudet
– Synnynnäinen lisämunuaisen liikakasvu (CAH)
Orgaanisten happojen aineenvaihdunnan häiriöt
– Synnynnäinen B12-vitamiinin puutos
– Glutaarihappovirtsaisuus tyyppi I (GA I)
– Isovaleerihappovirtsaisuus
– Metyylimalonihappovirtsaisuus
– Propionihappovirtsaisuus
Rasvahappojen aineenvaihdunnan häiriöt
– CACT (karnitiini-asyylikarnitiinitranslokaasin puutos)
– CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I
– CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II
– CUD (karnitiinin kuljetushäiriö)
– Glutaarihappovirtsaisuus tyyppi II (GA II)
– MCAD (keskipitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)
– LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli-CoA dehydrogenaasin puutos)/TFP (Trifunctional Protein Deficiency)
– VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-CoA-dehydrogenaasin puutos)
Ureasyklin häiriöt
– Sitrullinemia
– Arginiinimeripihkahappouria (ASA-uria)
– Argininemia

Poikkeavissa löydöksissä voinnin tarkistukseen liittyen tilattavia laboratoriotutkimuksia: P-Gluk, P-NH4ion, P-ALAT, P-GT, P-Bil, P-TT, P-OHBut, P-CK ja cB-VekaEl

Diagnoosin varmistamiseen mahdollisesti tarvittavia jatkotutkimuksia:
1061 fP-aminohapot
4855 U-Orgah
9268 B-Asyykar
1867 P-Hcyst (ainoastaan homokystinuriaepäilyssä)
3853 S-Karni-T
4147 S-MetMal (ainoastaan metyylimalonihappovirtsaisuutta tai sen ”sukulaisia” kuten B12-vitamiinipuutosta epäiltäessä)
4852 U-Sukkase (ainoastaan tyrosinemiaepäilyssä)
1644 S-17Hprog (CAH-epäilyssä)